PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000255884
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 346aa    MW: 39031.9 Da    PI: 8.6059
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000255884genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.62.5e-49151421128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhP+deel+v+yL++k+ + +l++ + i+e+d+yk++PwdLp+k+  +e+ewyfFs+rd+ky++g+r+nra++ gyWka g dk++l++ 
  MDP0000255884  15 LPPGFRFHPSDEELIVHYLRNKMISYPLPA-QLITEIDLYKYNPWDLPNKALFGEDEWYFFSPRDRKYPNGDRPNRAAALGYWKAAGGDKPILTSc 109
                    79****************************.89***************88888999*************************************998 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++el+g+kk Lvfy+grapkg+kt+W+m+eyrl
  MDP0000255884 110 GSELIGVKKALVFYTGRAPKGVKTEWLMNEYRL 142
                    8899***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.14E-6112168IPR003441NAC domain
PROSITE profilePS5100559.18915169IPR003441NAC domain
PfamPF023651.2E-2416142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MEKEPAFTTS STLQLPPGFR FHPSDEELIV HYLRNKMISY PLPAQLITEI DLYKYNPWDL  60
PNKALFGEDE WYFFSPRDRK YPNGDRPNRA AALGYWKAAG GDKPILTSCG SELIGVKKAL  120
VFYTGRAPKG VKTEWLMNEY RLLDSTINPS RSKGSMRLDD WVLCRVQQRG NTTKNTCNAQ  180
DIYNTESWRC LPKAGPTQPT DPIHRADLIT DFLYKDCRLL AFMLAGXAPS PIETNSSASF  240
QGSKDXCEVG SNNKVKSTIS ISSSGISSTL KRKIREENTK ESLFPLINLE SKNKYGNVLP  300
SKRLAAGNVV NCYIPNDLQN DIPKANPMVP ANFEEFNEMS FLATYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-701117513171NAC domain-containing protein 19
4dul_A2e-701117513171NAC domain-containing protein 19
1ut7_B2e-701117513171NO APICAL MERISTEM PROTEIN
1ut7_A2e-701117513171NO APICAL MERISTEM PROTEIN
1ut4_B2e-701117513171NO APICAL MERISTEM PROTEIN
1ut4_A2e-701117513171NO APICAL MERISTEM PROTEIN
3swp_D3e-701117516174NAC domain-containing protein 19
3swp_C3e-701117516174NAC domain-containing protein 19
3swp_B3e-701117516174NAC domain-containing protein 19
3swp_A3e-701117516174NAC domain-containing protein 19
3swm_D3e-701117516174NAC domain-containing protein 19
3swm_C3e-701117516174NAC domain-containing protein 19
3swm_B3e-701117516174NAC domain-containing protein 19
3swm_A3e-701117516174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008385394.10.0PREDICTED: NAC domain-containing protein 2-like
SwissprotQ52QH45e-76NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLM5W7331e-170M5W733_PRUPE; Uncharacterized protein
STRINGVIT_06s0004g03080.t011e-113(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-75NAC domain containing protein 25